PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA16897
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 380aa    MW: 41352.1 Da    PI: 8.4043
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA16897genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1245e-3957117262
                     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                +++al+cprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  Tp57577_TGAC_v2_mRNA16897  57 QQQALRCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 117
                                7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.2E-3359115IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-2960115IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4661115IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106399IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MFGNCVHEKT VITSNKLTQS IEIDDHHNNK VSISMASSSG GGNRVMEKPG QELVQQQQQA  60
LRCPRCDSSN TKFCYYNNYS LSQPRHFCKA CKRYWTRGGT LRNVPVGGGC RKNKRVKRPN  120
HSSSNNNIDS PSSSNPTSVT ANSNPSSQQQ HHSFDVANST SNHINTLLYG NNSCHDVMNF  180
PFATRFNSTR VSSSGSGYDH LQQNGLGLGF SPGLANLNHH DDYRNGFSTT SNNNNYSSIF  240
GSSMGSTTPV MSSLLSSTLL QQKFMSTVGG GGGGNDGSMK GDLFHHHDMK MEGNSRSDEV  300
ELMASKEGLN RLDQWNNNNM NGTNGVAFQN QMENMGLSDS GYWNNSNNNN NNIATTGLSS  360
IWSTDQPNNI GSNSVTSLI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP0156751e-82KP015675.1 Vicia sativa subsp. sativa SSR marker NAC-VSspS-235 mRNA sequence.
GenBankKP0156761e-82KP015676.1 Vicia sativa subsp. sativa SSR marker NAC-VSspS-236 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013456998.11e-162Dof-type zinc finger DNA-binding family protein
TrEMBLA0A072UML91e-162A0A072UML9_MEDTR; Dof-type zinc finger DNA-binding family protein
STRINGVIT_10s0003g00040.t012e-72(Vitis vinifera)
STRINGGLYMA13G24600.12e-72(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.22e-35Dof family protein